PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00043.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 360aa    MW: 41526.4 Da    PI: 5.4318
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00043.1_g00018.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.38.8e-51161441128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eel+++yL+kkv+++k++l +vi+evd++k+ePwd++++++     +++wyfFs++dkky+tg+r+nrat +g+W
  Rsa1.0_00043.1_g00018.1  16 VPPGFRFHPTEEELLHYYLRKKVHSQKIDL-DVIREVDLNKLEPWDIQEECRIgltPQNDWYFFSHKDKKYPTGTRTNRATVTGFW 100
                              69****************************.9***************963333233567*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk ++s   + +gl+ktLvfykgrap+gek+dW+mheyrl
  Rsa1.0_00043.1_g00018.1 101 KATGRDKIIYS-CVRRIGLRKTLVFYKGRAPHGEKSDWIMHEYRL 144
                              **********9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.18E-5612177IPR003441NAC domain
PROSITE profilePS5100555.62416177IPR003441NAC domain
PfamPF023659.2E-2717144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MAENKVNLSI NGQSKVPPGF RFHPTEEELL HYYLRKKVHS QKIDLDVIRE VDLNKLEPWD  60
IQEECRIGLT PQNDWYFFSH KDKKYPTGTR TNRATVTGFW KATGRDKIIY SCVRRIGLRK  120
TLVFYKGRAP HGEKSDWIMH EYRLDDTPTS NECSDVVTED PMSYNEDGWV VCRVFRKKNY  180
QKIDDSPKIT QSSSPDDTDE NKRPTTFHNT LNATVLDHVL LCMDRSGPNI SVPEVQTKTQ  240
HQDDLLFMQL PSLETPKSEN LVGQSLTTTN QLDSSLVQEK ITGRPVCSNW ASLDRLVAWQ  300
LNNGHLTCDR TSFDEEEEGD AMMQRWDLHW NNDDNVDIWS SFAESSSSLS SLDPLLHLSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-481617915170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00016PBMTransfer from AT1G32770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747550.0KF974755.1 Brassica napus NAC transcription factor 12-1 (NAC12-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151451.10.0PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 12-like
RefseqXP_013727089.10.0PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 12
SwissprotQ9LPI70.0NAC12_ARATH; NAC domain-containing protein 12
TrEMBLA0A078ENZ60.0A0A078ENZ6_BRANA; BnaC05g24890D protein
STRINGBra023288.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77828124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32770.10.0NAC domain containing protein 12